PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1564
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 304aa    MW: 34601.9 Da    PI: 7.0514
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1564genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.3e-182673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++++G g+W+  a++ g++Rt+k+c++rw++yl
      Gh_A01G1564 26 RGPWTLEEDTLLTHYIARHGEGRWNMLAKCAGLKRTGKSCRLRWLNYL 73
                     89********************************************97 PP

2Myb_DNA-binding52.61e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A01G1564  79 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 122
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6752173IPR017930Myb domain
SuperFamilySSF466895.24E-3124120IPR009057Homeodomain-like
SMARTSM007175.8E-152575IPR001005SANT/Myb domain
PfamPF002491.0E-152673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-232780IPR009057Homeodomain-like
CDDcd001671.04E-112873No hitNo description
PROSITE patternPS0017504150IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.75174128IPR017930Myb domain
SMARTSM007172.7E-1578126IPR001005SANT/Myb domain
PfamPF002491.0E-1579122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2381127IPR009057Homeodomain-like
CDDcd001678.24E-1283122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MRAAMPPINT KNMSTPLEEE ESELRRGPWT LEEDTLLTHY IARHGEGRWN MLAKCAGLKR  60
TGKSCRLRWL NYLKPDIKRG NLTPQEQLLI LELHSKWGNR WSKIAQHLPG RTDNEIKNYW  120
RTRVQKQARQ LNIESNSQRF LDAVRCFWMP RLVQKVEQAS PSSSSSSSSS YLKEMCTQSS  180
VPSQLSSCCT VPSFPTFSPL ANKTTDISNS SSVTTQNICP TDSINISDQT EIPQHLTGSN  240
VYSHTTLDQC YNIDSNDYGM EGISFASMSA VGFYEGTSSE GNWMCTEMSD NLWNMDDIWQ  300
LRSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-252312824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2430920.0AC243092.1 Gossypioides kirkii clone GKH058K14-jmr, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467885.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0D2RAK10.0A0A0D2RAK1_G
STRINGPOPTR_0008s12130.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.15e-91myb domain protein 62